Lineage for d1owfa_ (1owf A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
core: 4 helices; bundle, partly opened, capped with a beta-sheetSuperfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) 
dimer of identical subunits
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
automatically mapped to Pfam PF00216
Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
heterodimer of two related subunitsSpecies Escherichia coli [TaxId:562] [88879] (4 PDB entries) 
Domain d1owfa_: 1owf A: [87487]
Other proteins in same PDB: d1owfb_
protein/DNA complex; mutant
Details for d1owfa_
PDB Entry: 1owf (more details), 1.95 Å
PDB Description: crystal structure of a mutant ihf (betae44a) complexed with the native h' site
PDB Compounds: (A:) Integration host factor alpha-subunitSCOPe Domain Sequences for d1owfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owfa_ a.55.1.1 (A:) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk
SCOPe Domain Coordinates for d1owfa_:
Click to download the PDB-style file with coordinates for d1owfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1owfa_:
- d1owfa_ first appeared in SCOP 1.65
- d1owfa_ appears in SCOPe 2.07
View in 3D
