Lineage for d1ow0a1 (1ow0 A:242-342)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515152Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)
  7. 1515153Species Human (Homo sapiens) [TaxId:9606] [89182] (2 PDB entries)
  8. 1515154Domain d1ow0a1: 1ow0 A:242-342 [87477]
    Other proteins in same PDB: d1ow0a2, d1ow0b2, d1ow0c1, d1ow0c2, d1ow0d1, d1ow0d2
    complexed with nag

Details for d1ow0a1

PDB Entry: 1ow0 (more details), 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc
PDB Compounds: (A:) Ig alpha-1 chain C region

SCOPe Domain Sequences for d1ow0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

SCOPe Domain Coordinates for d1ow0a1:

Click to download the PDB-style file with coordinates for d1ow0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ow0a1:

1515154
d1ow0a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ow0a2