Lineage for d1ovzb2 (1ovz B:101-193)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
possibly an intermediate structure between the I set and FnIII domainsSpecies Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries) 
Domain d1ovzb2: 1ovz B:101-193 [87476]
complexed with nag, trs
Details for d1ovzb2
PDB Entry: 1ovz (more details), 3 Å
PDB Description: crystal structure of human fcari
PDB Compounds: (B:) Immunoglobulin alpha Fc receptorSCOPe Domain Sequences for d1ovzb2:
Sequence, based on SEQRES records: (download)
>d1ovzb2 b.1.1.4 (B:101-193) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
lygkpflsadrglvlmpgenisltcssahipfdrfslakegelslpqhqsgehpanfslg
pvdlnvsgiyrcygwynrspylwsfpsnalelv
Sequence, based on observed residues (ATOM records): (download)
>d1ovzb2 b.1.1.4 (B:101-193) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
lygkpflsadrltcssahipfdrfslakegelslpqhqsgehpanfslgpvdlnvsgiyr
cygwynrspylwsfpsnalelv
SCOPe Domain Coordinates for d1ovzb2:
Click to download the PDB-style file with coordinates for d1ovzb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ovzb2:
- d1ovzb2 first appeared in SCOP 1.65
- d1ovzb2 appears in SCOPe 2.02
- d1ovzb2 appears in SCOPe 2.04
- d1ovzb2 appears in the current release, SCOPe 2.08
View in 3D
