Lineage for d1ovzb1 (1ovz B:2-100)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031531Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2031685Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2031686Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)
  8. 2031691Domain d1ovzb1: 1ovz B:2-100 [87475]
    Other proteins in same PDB: d1ovza3
    complexed with nag, trs

Details for d1ovzb1

PDB Entry: 1ovz (more details), 3 Å

PDB Description: crystal structure of human fcari
PDB Compounds: (B:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ovzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ovzb1 b.1.1.4 (B:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
egdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnetd
pefvidhmdankagryqcqyrighyrfrysdtlelvvtg

SCOPe Domain Coordinates for d1ovzb1:

Click to download the PDB-style file with coordinates for d1ovzb1.
(The format of our PDB-style files is described here.)

Timeline for d1ovzb1:

2031691
d1ovzb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1ovzb2