Lineage for d1osma_ (1osm A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3022096Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 3022097Family f.4.3.1: Porin [56936] (2 proteins)
    trimer, one subunit folds into (16,20) barrel
  6. 3022098Protein Porin [56937] (5 species)
  7. 3022155Species Klebsiella pneumoniae [TaxId:573] [56941] (1 PDB entry)
  8. 3022156Domain d1osma_: 1osm A: [43769]
    osmoporin ompk36
    complexed with d12

Details for d1osma_

PDB Entry: 1osm (more details), 3.2 Å

PDB Description: osmoporin (ompk36) from klebsiella pneumoniae
PDB Compounds: (A:) ompk36

SCOPe Domain Sequences for d1osma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osma_ f.4.3.1 (A:) Porin {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddkdvdgdqtymrlgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgalkqngdgfgts
vtydifdgisagfayanskrtddqnqlllgegdhaetytgglkydanniylatqytqtyn
atragslgfankaqnfevaaqyqfdfglrpsvaylqskgkdlngygdqdilkyvdvgaty
yfnknmstyvdykinllddnsftrsagistddvvalglvyqf

SCOPe Domain Coordinates for d1osma_:

Click to download the PDB-style file with coordinates for d1osma_.
(The format of our PDB-style files is described here.)

Timeline for d1osma_: