Lineage for d1os1a1 (1os1 A:228-540)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1877881Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 1877882Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 1877883Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 proteins)
  6. 1877934Protein Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) [68921] (4 species)
  7. 1877938Species Escherichia coli [TaxId:562] [53798] (10 PDB entries)
  8. 1877941Domain d1os1a1: 1os1 A:228-540 [93467]
    Other proteins in same PDB: d1os1a2
    complexed with atp, ca, mg, pyr

Details for d1os1a1

PDB Entry: 1os1 (more details), 1.8 Å

PDB Description: Structure of Phosphoenolpyruvate Carboxykinase complexed with ATP,Mg, Ca and pyruvate.
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [ATP]

SCOPe Domain Sequences for d1os1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1os1a1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

SCOPe Domain Coordinates for d1os1a1:

Click to download the PDB-style file with coordinates for d1os1a1.
(The format of our PDB-style files is described here.)

Timeline for d1os1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1os1a2