Lineage for d1oqxa1 (1oqx A:236-341)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761466Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1761467Species Human (Homo sapiens) [TaxId:9606] [88585] (41 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1761501Domain d1oqxa1: 1oqx A:236-341 [87325]
    Other proteins in same PDB: d1oqxa2, d1oqxb2, d1oqxc_, d1oqxd_
    part of a Fc

Details for d1oqxa1

PDB Entry: 1oqx (more details), 2.6 Å

PDB Description: g-2 glycovariant of human igg fc bound to minimized version of protein a called z34c
PDB Compounds: (A:) immunoglobulin gamma-1 heavy chain constant region

SCOPe Domain Sequences for d1oqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqxa1 b.1.1.2 (A:236-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1oqxa1:

Click to download the PDB-style file with coordinates for d1oqxa1.
(The format of our PDB-style files is described here.)

Timeline for d1oqxa1:

1761501
d1oqxa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1oqxa2