Lineage for d1op9a_ (1op9 A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Camelid IG heavy chain variable domain, VHh [88563] (3 species) Species Camel (Camelus dromedarius) [TaxId:9838] [88564] (19 PDB entries)
SQ NA # camelid antibody
Domain d1op9a_: 1op9 A: [93398]
Other proteins in same PDB: d1op9b_
anti-lysozyme Hl6 VHh domain
Details for d1op9a_
PDB Entry: 1op9 (more details), 1.86 Å
PDB Description: complex of human lysozyme with camelid vhh hl6 antibody fragment
PDB Compounds: (A:) HL6 camel VHH fragmentSCOPe Domain Sequences for d1op9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1op9a_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesgggsvqaggslrlscsasgytyisgwfrqapgkeregvaairssdgttyyads
vkgrftisqdnakntvylqmnslkpedtamyycaatevagwpldigiydywgqgtevtvs
s
SCOPe Domain Coordinates for d1op9a_:
Click to download the PDB-style file with coordinates for d1op9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1op9a_:
- d1op9a_ first appeared in SCOP 1.67
- d1op9a_ appears in SCOPe 2.05
- d1op9a_ is called d1op9a1 in SCOPe 2.07
- d1op9a_ appears in the current release, SCOPe 2.08, called d1op9a1
View in 3D
