Lineage for d1on4a_ (1on4 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853805Protein Thioredoxin-like protein Sco1 (YpmQ), soluble domain [102459] (3 species)
  7. 1853806Species Bacillus subtilis [TaxId:1423] [102460] (2 PDB entries)
  8. 1853809Domain d1on4a_: 1on4 A: [93355]

Details for d1on4a_

PDB Entry: 1on4 (more details)

PDB Description: solution structure of soluble domain of sco1 from bacillus subtilis
PDB Compounds: (A:) Sco1

SCOPe Domain Sequences for d1on4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on4a_ c.47.1.10 (A:) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}
hmleikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlq
kklkaenidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksf
kaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk

SCOPe Domain Coordinates for d1on4a_:

Click to download the PDB-style file with coordinates for d1on4a_.
(The format of our PDB-style files is described here.)

Timeline for d1on4a_: