Lineage for d1omeb_ (1ome B:)
- Root: SCOPe 2.08
Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
Protein beta-Lactamase, class A [56606] (16 species) 
Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) 
Domain d1omeb_: 1ome B: [42718]
omega loop deletion mutant (residues 163-178 deleted)
complexed with cl; mutant
Details for d1omeb_
PDB Entry: 1ome (more details), 2.3 Å
PDB Description: crystal structure of the omega loop deletion mutant (residues 163-178 deleted) of beta-lactamase from staphylococcus aureus pc1
PDB Compounds: (B:) Beta-lactamaseSCOPe Domain Sequences for d1omeb_:
Sequence, based on SEQRES records: (download)
>d1omeb_ e.3.1.1 (B:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
elndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnkk
vhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlke
lgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmlnn
ksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdkp
ndklisetaksvmkef
Sequence, based on observed residues (ATOM records): (download)
>d1omeb_ e.3.1.1 (B:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]}
elndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnkk
vhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlke
lgdkvtnpdtstpaafgktlnkliangklskenkkflldlmlnnksgdtlikdgvpkdyk
vadksgqaityasrndvafvypkgqsepivlviftnkdnksdkpndklisetaksvmkef
SCOPe Domain Coordinates for d1omeb_:
Click to download the PDB-style file with coordinates for d1omeb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1omeb_:
- d1omeb_ first appeared (with stable ids) in SCOP 1.55
- d1omeb_ appears in SCOPe 2.07
View in 3D
