Lineage for d1ol5a_ (1ol5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2218253Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
    OPK group; AIRK subfamily; serine/threonine kinase
  7. 2218254Species Human (Homo sapiens) [TaxId:9606] [90039] (62 PDB entries)
  8. 2218267Domain d1ol5a_: 1ol5 A: [93310]
    complexed with a tpx2 peptide, chain B
    complexed with adp, mg, so4

Details for d1ol5a_

PDB Entry: 1ol5 (more details), 2.5 Å

PDB Description: structure of aurora-a 122-403, phosphorylated on thr287, thr288 and bound to tpx2 1-43
PDB Compounds: (A:) serine/threonine kinase 6

SCOPe Domain Sequences for d1ol5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ol5a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev
eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan
alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemie
grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr
llkhnpsqrpmlrevlehpwitanss

SCOPe Domain Coordinates for d1ol5a_:

Click to download the PDB-style file with coordinates for d1ol5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ol5a_: