Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Domain d1ol5a_: 1ol5 A: [93310] complexed with a tpx2 peptide, chain B complexed with adp, mg, so4 |
PDB Entry: 1ol5 (more details), 2.5 Å
SCOPe Domain Sequences for d1ol5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ol5a_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} skkrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrev eiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelan alsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemie grmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisr llkhnpsqrpmlrevlehpwitanss
Timeline for d1ol5a_: