Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Salmonella typhimurium [TaxId:602] [254883] (1 PDB entry) |
Domain d1ojlb_: 1ojl B: [240746] automated match to d1ny6c_ complexed with atp, po4 |
PDB Entry: 1ojl (more details), 3 Å
SCOPe Domain Sequences for d1ojlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ojlb_ c.37.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 602]} shmigsspamqhllneiamvapsdatvlihgdsgtgkelvaralhacsarsdrplvtlnc aalneslleselfghekgaftgadkrregrfveadggtlfldeigdisplmqvrllraiq erevqrvgsnqtisvdvrliaathrdlaeevsagrfrqdlyyrlnvvaiempslrqrred iplladhflrrfaernrkvvkgftpqamdllihydwpgnirelenaieravvlltgeyis erelplaiaat
Timeline for d1ojlb_: