Lineage for d1oiva_ (1oiv A:)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (79 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein Rab11a [102362] (2 species) Species Human (Homo sapiens) [TaxId:9606] [102363] (5 PDB entries) 
Domain d1oiva_: 1oiv A: [93076]
complexed with edo, gdp, so4
Details for d1oiva_
PDB Entry: 1oiv (more details), 1.98 Å
PDB Description: x-ray structure of the small g protein rab11a in complex with gdp
PDB Compounds: (A:) Ras-related protein Rab-11ASCOPe Domain Sequences for d1oiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oiva_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
SCOPe Domain Coordinates for d1oiva_:
Click to download the PDB-style file with coordinates for d1oiva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oiva_:
- d1oiva_ first appeared in SCOP 1.67
- d1oiva_ appears in SCOP 1.75
- d1oiva_ appears in SCOPe 2.02
- d1oiva_ appears in the current release, SCOPe 2.08
View in 3D
