Lineage for d1oi7a1 (1oi7 A:1-121)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 822143Family c.2.1.8: CoA-binding domain [51900] (5 proteins)
  6. 822160Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (3 species)
  7. 822193Species Thermus thermophilus [TaxId:274] [89541] (1 PDB entry)
  8. 822194Domain d1oi7a1: 1oi7 A:1-121 [87049]
    Other proteins in same PDB: d1oi7a2
    alpha-chain only
    mutant

Details for d1oi7a1

PDB Entry: 1oi7 (more details), 1.23 Å

PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus
PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOP Domain Sequences for d1oi7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]}
milvnretrvlvqgitgregqfhtkqmltygtkivagvtpgkggmevlgvpvydtvkeav
ahhevdasiifvpapaaadaaleaahagiplivlitegiptldmvraveeikalgsrlig
g

SCOP Domain Coordinates for d1oi7a1:

Click to download the PDB-style file with coordinates for d1oi7a1.
(The format of our PDB-style files is described here.)

Timeline for d1oi7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi7a2