Lineage for d1ohqa_ (1ohq A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Engineered (including hybrid species) [88562] (68 PDB entries)
SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
Domain d1ohqa_: 1ohq A: [93027]
soluble VH Hel4, resistant to aggregation
Details for d1ohqa_
PDB Entry: 1ohq (more details), 2 Å
PDB Description: crystal structure of hel4, a soluble human vh antibody domain resistant to aggregation
PDB Compounds: (A:) immunoglobulinSCOPe Domain Sequences for d1ohqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohqa_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss
SCOPe Domain Coordinates for d1ohqa_:
Click to download the PDB-style file with coordinates for d1ohqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ohqa_:
- d1ohqa_ first appeared in SCOP 1.67
- d1ohqa_ appears in SCOPe 2.05
- d1ohqa_ appears in SCOPe 2.07
- d1ohqa_ appears in the current release, SCOPe 2.08
View in 3D
