![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
![]() | Superfamily h.4.8: F1 ATPase inhibitor, IF1, C-terminal domain [64602] (1 family) ![]() |
![]() | Family h.4.8.1: F1 ATPase inhibitor, IF1, C-terminal domain [64603] (2 proteins) |
![]() | Domain d1ohhh_: 1ohh H: [87034] Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_ complexed with anp, mg |
PDB Entry: 1ohh (more details), 2.8 Å
SCOPe Domain Sequences for d1ohhh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohhh_ h.4.8.1 (H:) F1 ATPase inhibitor, IF1, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} sgdnvrssagavrdaggafgkreqaeeeryfrarake
Timeline for d1ohhh_: