Lineage for d1oepa2 (1oep A:-2-138)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
C-terminal domain is beta/alpha-barrel
Protein Enolase [54828] (10 species) 
Species Trypanosoma brucei brucei [TaxId:5702] [89925] (1 PDB entry) 
Domain d1oepa2: 1oep A:-2-138 [86919]
Other proteins in same PDB: d1oepa1
complexed with edo, so4, zn
Details for d1oepa2
PDB Entry: 1oep (more details), 2.3 Å
PDB Description: structure of trypanosoma brucei enolase reveals the inhibitory divalent metal site
PDB Compounds: (A:) enolaseSCOPe Domain Sequences for d1oepa2:
Sequence, based on SEQRES records: (download)
>d1oepa2 d.54.1.1 (A:-2-138) Enolase {Trypanosoma brucei brucei [TaxId: 5702]}
shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgastgvyeacelrdgdkkryv
gkgclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaisk
aaaaakgvplyrylaslagt
Sequence, based on observed residues (ATOM records): (download)
>d1oepa2 d.54.1.1 (A:-2-138) Enolase {Trypanosoma brucei brucei [TaxId: 5702]}
shmtiqkvhgrevldsrgnptvevevttekgvfrsavpsgasvyeacelrdgdkkryvgk
gclqavknvnevigpaligrdelkqeeldtlmlrldgtpnkgklganailgcsmaiskaa
aaakgvplyrylaslagt
SCOPe Domain Coordinates for d1oepa2:
Click to download the PDB-style file with coordinates for d1oepa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oepa2:
- d1oepa2 first appeared in SCOP 1.65
- d1oepa2 appears in SCOPe 2.07
View in 3D
