Lineage for d1occg_ (1occ G:)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887161Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 887162Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)
  6. 887163Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 887164Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)
  8. 887187Domain d1occg_: 1occ G: [43562]
    Other proteins in same PDB: d1occa_, d1occb1, d1occb2, d1occc_, d1occd_, d1occe_, d1occf_, d1occh_, d1occi_, d1occj_, d1occk_, d1occl_, d1occm_, d1occn_, d1occo1, d1occo2, d1occp_, d1occq_, d1occr_, d1occs_, d1occu_, d1occv_, d1occw_, d1occx_, d1occy_, d1occz_

Details for d1occg_

PDB Entry: 1occ (more details), 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (G:) cytochrome c oxidase

SCOP Domain Sequences for d1occg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1occg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOP Domain Coordinates for d1occg_:

Click to download the PDB-style file with coordinates for d1occg_.
(The format of our PDB-style files is described here.)

Timeline for d1occg_: