Lineage for d1oafa_ (1oaf A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773244Protein Ascorbate peroxidase [48123] (3 species)
  7. 773252Species Soybean (Glycine max) [TaxId:3847] [89092] (6 PDB entries)
    Uniprot Q43758
  8. 773253Domain d1oafa_: 1oaf A: [86734]
    complexed with asc, hem, na

Details for d1oafa_

PDB Entry: 1oaf (more details), 1.4 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with ascorbate
PDB Compounds: (A:) ascorbate peroxidase

SCOP Domain Sequences for d1oafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

SCOP Domain Coordinates for d1oafa_:

Click to download the PDB-style file with coordinates for d1oafa_.
(The format of our PDB-style files is described here.)

Timeline for d1oafa_: