Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species) |
Species Elephant shrew (Elephantulus edwardii) [TaxId:28737] [89780] (1 PDB entry) cytosolic form; eta-crystallin |
Domain d1o9ja_: 1o9j A: [86694] complexed with dtt, dtu, nad |
PDB Entry: 1o9j (more details), 2.4 Å
SCOPe Domain Sequences for d1o9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9ja_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Elephant shrew (Elephantulus edwardii) [TaxId: 28737]} dlpapltnikiqhtklfinnewhesvsgktfpvfnpateekiceveeadkedvdkavkaa reafqmgspwrtmdasergqliykladlierdrlllatlesinagkvfasaylmdldyci kalrycagwadkiqgrtipvdgeffsytrhepigvcglifpwnapmillackigpalccg ntvivkpaeqtpltalhvaslikeagfppgvvnivpgygptagaaisshmdvdkvaftgs tevgkmiqeaaaksnlkrvtlelgaknpcivfadadldsavefahqgvftnqgqsciaas klfveeaiydefvqrsverakkyvfgnpltpgvnhgpqinkaqhnkimeliesgkkegak lecgggpwgnkgyfiqptvfsnvtddmriakeeifgpvqqimkfksldevikranntyyg lvagvftkdldkavtvssalqagtvwvncylaasaqspaggfkmsghgremgeygiheyt evktvtmkisekns
Timeline for d1o9ja_: