Lineage for d1o6ya_ (1o6y A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2197646Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
    OPK group; PKN subfamily; serine/threonine kinase
  7. 2197647Species Mycobacterium tuberculosis [TaxId:1773] [82794] (3 PDB entries)
  8. 2197648Domain d1o6ya_: 1o6y A: [81106]
    complexed with acp, mg

Details for d1o6ya_

PDB Entry: 1o6y (more details), 2.2 Å

PDB Description: catalytic domain of pknb kinase from mycobacterium tuberculosis
PDB Compounds: (A:) serine/threonine-protein kinase pknb

SCOPe Domain Sequences for d1o6ya_:

Sequence, based on SEQRES records: (download)

>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
lsadldavvlkalaknpenryqtaaemradlvrvhn

Sequence, based on observed residues (ATOM records): (download)

>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiaqylspeqargdsvdarsd
vyslgcvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalakn
penryqtaaemradlvrvhn

SCOPe Domain Coordinates for d1o6ya_:

Click to download the PDB-style file with coordinates for d1o6ya_.
(The format of our PDB-style files is described here.)

Timeline for d1o6ya_: