Lineage for d1o51a_ (1o51 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907450Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1907700Family d.58.5.4: DUF190/COG1993 [89934] (1 protein)
    automatically mapped to Pfam PF02641
  6. 1907701Protein Hypothetical protein TM0021 [89935] (1 species)
  7. 1907702Species Thermotoga maritima [TaxId:2336] [89936] (1 PDB entry)
  8. 1907703Domain d1o51a_: 1o51 A: [92480]
    structural genomics
    complexed with adp, so4

Details for d1o51a_

PDB Entry: 1o51 (more details), 2.5 Å

PDB Description: crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution
PDB Compounds: (A:) Hypothetical protein TM0021

SCOPe Domain Sequences for d1o51a_:

Sequence, based on SEQRES records: (download)

>d1o51a_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffsl
spdlpivleivdeeerinlflkeidnidfdglvftadvnvvk

Sequence, based on observed residues (ATOM records): (download)

>d1o51a_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga maritima [TaxId: 2336]}
hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivde
eerinlflkeidnidfdglvftadvnvvk

SCOPe Domain Coordinates for d1o51a_:

Click to download the PDB-style file with coordinates for d1o51a_.
(The format of our PDB-style files is described here.)

Timeline for d1o51a_: