Lineage for d1o4sb_ (1o4s B:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the restSuperfamily c.67.1: PLP-dependent transferases [53383] (10 families) 
Family c.67.1.1: AAT-like [53384] (17 proteins) 
Protein Aspartate aminotransferase, AAT [53385] (8 species) 
Species Thermotoga maritima [TaxId:2336] [89754] (1 PDB entry)
TM1255
Domain d1o4sb_: 1o4s B: [86621]
structural genomics
complexed with plp, so4
Details for d1o4sb_
PDB Entry: 1o4s (more details), 1.9 Å
PDB Description: crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution
PDB Compounds: (B:) aspartate aminotransferaseSCOPe Domain Sequences for d1o4sb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o4sb_ c.67.1.1 (B:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]}
kihhhhhhmvsrriseipisktmeldakakalikkgedvinltagepdfptpepvveeav
rflqkgevkytdprgiyelregiakrigerykkdispdqvvvtngakqalfnafmalldp
gdevivfspvwvsyipqiilaggtvnvvetfmsknfqpsleevegllvgktkavlinspn
nptgvvyrrefleglvrlakkrnfyiisdevydslvytdeftsildvsegfdrivyingf
skshsmtgwrvgylissekvatavskiqshttscintvaqyaalkalevdnsymvqtfke
rknfvverlkkmgvkfvepegafylffkvrgddvkfcerlleekkvalvpgsaflkpgfv
rlsfatsierltealdriedflns
SCOPe Domain Coordinates for d1o4sb_:
Click to download the PDB-style file with coordinates for d1o4sb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1o4sb_:
- d1o4sb_ first appeared in SCOP 1.65
- d1o4sb_ appears in SCOPe 2.02
- d1o4sb_ appears in SCOPe 2.04
- d1o4sb_ appears in the current release, SCOPe 2.08, called d1o4sb1
View in 3D
