Lineage for d1nz6b_ (1nz6 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1256372Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1256495Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 1256496Family a.2.3.1: Chaperone J-domain [46566] (8 proteins)
    Pfam PF00226
  6. 1256497Protein Auxilin J-domain [88969] (1 species)
  7. 1256498Species Cow (Bos taurus) [TaxId:9913] [88970] (2 PDB entries)
  8. 1256500Domain d1nz6b_: 1nz6 B: [86442]

Details for d1nz6b_

PDB Entry: 1nz6 (more details), 2.5 Å

PDB Description: Crystal Structure of Auxilin J-Domain
PDB Compounds: (B:) Auxilin

SCOPe Domain Sequences for d1nz6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz6b_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
mdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavl
vvhpdkatgqpyeqyakmifmelndawsefenqgqkply

SCOPe Domain Coordinates for d1nz6b_:

Click to download the PDB-style file with coordinates for d1nz6b_.
(The format of our PDB-style files is described here.)

Timeline for d1nz6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nz6a_