Lineage for d1nyxa_ (1nyx A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48525] (94 PDB entries)
Uniprot P37231 232-505
Domain d1nyxa_: 1nyx A: [86431]
complexed with drf
Details for d1nyxa_
PDB Entry: 1nyx (more details), 2.65 Å
PDB Description: Ligand binding domain of the human peroxisome proliferator activated receptor gamma in complex with an agonist
PDB Compounds: (A:) Peroxisome proliferator activated receptor gammaSCOPe Domain Sequences for d1nyxa_:
Sequence, based on SEQRES records: (download)
>d1nyxa_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
lrqivtehvqllqvikktetdmslhpllqeiykdl
Sequence, based on observed residues (ATOM records): (download)
>d1nyxa_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
kktetdmslhpllqeiykdl
SCOPe Domain Coordinates for d1nyxa_:
Click to download the PDB-style file with coordinates for d1nyxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nyxa_:
- d1nyxa_ first appeared in SCOP 1.65
- d1nyxa_ appears in SCOPe 2.04
- d1nyxa_ appears in SCOPe 2.06
- d1nyxa_ appears in the current release, SCOPe 2.08
View in 3D
