Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries) |
Domain d1ny6c_: 1ny6 C: [92323] AAA+ domain only in the active state complexed with adp |
PDB Entry: 1ny6 (more details), 3.1 Å
SCOPe Domain Sequences for d1ny6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny6c_ c.37.1.20 (C:) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} eeyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnv asiprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvie sgkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerked iiplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfid rgelsclv
Timeline for d1ny6c_: