Lineage for d1nqdb_ (1nqd B:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (35 families) 
Family b.18.1.36: Collagen-binding domain [267607] (1 protein)
PubMed 17977833 describes likely homology between (d2quoa_), (d1w99a3), and (d1nqdb_)Protein Class 1 collagenase [267633] (1 species) Species Clostridium histolyticum [TaxId:1498] [267693] (4 PDB entries) 
Domain d1nqdb_: 1nqd B: [86026]
complexed with ca
Details for d1nqdb_
PDB Entry: 1nqd (more details), 1.65 Å
PDB Description: crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.65 angstrom resolution in presence of calcium
PDB Compounds: (B:) class 1 collagenaseSCOPe Domain Sequences for d1nqdb_:
Sequence, based on SEQRES records: (download)
>d1nqdb_ b.18.1.36 (B:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
ipgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkd
efgvtwtlhpesnindritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk
Sequence, based on observed residues (ATOM records): (download)
>d1nqdb_ b.18.1.36 (B:) Class 1 collagenase {Clostridium histolyticum [TaxId: 1498]}
ipgneklkekenndssdkatvipnfnttmqgsllgddsrdyysfevkeegevnieldkkd
efgvtwtlhpesritygqvdgnkvsnkvklrpgkyyllvykysgsgnyelrvnk
SCOPe Domain Coordinates for d1nqdb_:
Click to download the PDB-style file with coordinates for d1nqdb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nqdb_:
- d1nqdb_ first appeared in SCOP 1.65
- d1nqdb_ appears in SCOPe 2.04
- d1nqdb_ is called d1nqdb1 in SCOPe 2.06
- d1nqdb_ appears in the current release, SCOPe 2.08, called d1nqdb1
View in 3D
