Lineage for d1nqba1 (1nqb A:2-120)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered speciesSpecies Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
Domain d1nqba1: 1nqb A:2-120 [20042]
Other proteins in same PDB: d1nqba2, d1nqbc2
part of scFv trivalent antibody; N-terminal, VH domain is from B1-8 antibody (1A6U CH H); C-terminal, VL domain is from NQ11 antibody
Details for d1nqba1
PDB Entry: 1nqb (more details), 2 Å
PDB Description: trivalent antibody fragment
PDB Compounds: (A:) single-chain antibody fragmentSCOPe Domain Sequences for d1nqba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqba1 b.1.1.1 (A:2-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss
SCOPe Domain Coordinates for d1nqba1:
Click to download the PDB-style file with coordinates for d1nqba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nqba1:
- d1nqba1 first appeared (with stable ids) in SCOP 1.55
- d1nqba1 appears in SCOPe 2.07
View in 3D
