Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101511] (4 PDB entries) |
Domain d1npua_: 1npu A: [92038] |
PDB Entry: 1npu (more details), 2 Å
SCOPe Domain Sequences for d1npua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npua_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvteril
Timeline for d1npua_: