Lineage for d1np6a_ (1np6 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologiesFamily c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
core: parallel beta-sheet of 7 strands; order 3241567
Protein Molybdopterin-guanine dinucleotide biosynthesis protein MobB [89673] (2 species)
forms segment-swapped dimerSpecies Escherichia coli [TaxId:562] [89674] (2 PDB entries) 
Domain d1np6a_: 1np6 A: [85954]
complexed with so4
Details for d1np6a_
PDB Entry: 1np6 (more details), 1.9 Å
PDB Description: crystal structure of escherichia coli mobb
PDB Compounds: (A:) Molybdopterin-guanine dinucleotide biosynthesis protein BSCOPe Domain Sequences for d1np6a_:
Sequence, based on SEQRES records: (download)
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}
mipllafaawsgtgkttllkklipalcargirpglikhthhdmdvdkpgkdsyelrkaga
aqtivasqqrwalmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdga
ghrpeelvidrhviavasdvplnldvalldindvegladfvvewmqkqng
Sequence, based on observed residues (ATOM records): (download)
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}
mipllafaawsgtgkttllkklipalcargirpglikhthhelrkagaaqtivasqqrwa
lmtetpdeeeldlqflasrmdtskldlilvegfkheeiakivlfrdgaghrpeelvidrh
viavasdvplnldvalldindvegladfvvewmqkqng
SCOPe Domain Coordinates for d1np6a_:
Click to download the PDB-style file with coordinates for d1np6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1np6a_:
- d1np6a_ first appeared in SCOP 1.65
- d1np6a_ appears in SCOPe 2.04
- d1np6a_ appears in SCOPe 2.06
- d1np6a_ appears in the current release, SCOPe 2.08
View in 3D
