Lineage for d1nlbl1 (1nlb L:1-107)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries) 
Domain d1nlbl1: 1nlb L:1-107 [80623]
Other proteins in same PDB: d1nlbh1, d1nlbh2, d1nlbl2
part of anti-HCV Fab 19D9D6
Details for d1nlbl1
PDB Entry: 1nlb (more details), 1.6 Å
PDB Description: crystal structure of anti-HCV monoclonal antibody 19D9D6
PDB Compounds: (L:) antibody 19D9D6 light chainSCOPe Domain Sequences for d1nlbl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlbl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk
SCOPe Domain Coordinates for d1nlbl1:
Click to download the PDB-style file with coordinates for d1nlbl1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nlbl1:
- d1nlbl1 first appeared in SCOP 1.63
- d1nlbl1 appears in SCOPe 2.06
- d1nlbl1 appears in the current release, SCOPe 2.08
View in 3D
