Lineage for d1nk2p_ (1nk2 P:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1477566Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1477567Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1477740Protein VND/NK-2 protein [46724] (1 species)
  7. 1477741Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46725] (4 PDB entries)
  8. 1477743Domain d1nk2p_: 1nk2 P: [16015]
    protein/DNA complex

Details for d1nk2p_

PDB Entry: 1nk2 (more details)

PDB Description: vnd/nk-2 homeodomain/dna complex, nmr, 20 structures
PDB Compounds: (P:) homeobox protein vnd

SCOPe Domain Sequences for d1nk2p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk2p_ a.4.1.1 (P:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
asdglpnkkrkrrvlftkaqtyelerrfrqqrylsaperehlaslirltptqvkiwfqnh
ryktkraqnekgyeghp

SCOPe Domain Coordinates for d1nk2p_:

Click to download the PDB-style file with coordinates for d1nk2p_.
(The format of our PDB-style files is described here.)

Timeline for d1nk2p_: