Lineage for d1njmk_ (1njm K:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249275Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1249411Domain d1njmk_: 1njm K: [80548]
    complexed with a tRNA acceptor stem mimic (asm) and the antibiotic sparsomycin
    protein/RNA complex; complexed with sps

Details for d1njmk_

PDB Entry: 1njm (more details), 3.6 Å

PDB Description: The crystal structure of the 50S Large ribosomal subunit from Deinococcus radiodurans complexed with a tRNA acceptor stem mimic (ASM) and the antibiotic sparsomycin
PDB Compounds: (K:) 50S ribosomal protein L16

SCOPe Domain Sequences for d1njmk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1njmk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

SCOPe Domain Coordinates for d1njmk_:

Click to download the PDB-style file with coordinates for d1njmk_.
(The format of our PDB-style files is described here.)

Timeline for d1njmk_: