Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
Domain d1njmk_: 1njm K: [80548] complexed with a tRNA acceptor stem mimic (asm) and the antibiotic sparsomycin protein/RNA complex; complexed with sps |
PDB Entry: 1njm (more details), 3.6 Å
SCOPe Domain Sequences for d1njmk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njmk_ i.1.1.2 (K:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]} tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp iqtk
Timeline for d1njmk_: