Lineage for d1nh8a1 (1nh8 A:1-210)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the restSuperfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) 
Similar in architecture to the superfamily I but partly differs in topologyFamily c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
has additional insertions and/or extensions that are not grouped together
Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (5 species)
there is an additional C-terminal allosteric domain in some species
Species Mycobacterium tuberculosis [TaxId:1773] [82560] (2 PDB entries) 
Domain d1nh8a1: 1nh8 A:1-210 [80507]
Other proteins in same PDB: d1nh8a2
complexed with amp, his, so4
Details for d1nh8a1
PDB Entry: 1nh8 (more details), 1.8 Å
PDB Description: atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine
PDB Compounds: (A:) ATP phosphoribosyltransferaseSCOPe Domain Sequences for d1nh8a1:
Sequence, based on SEQRES records: (download)
>d1nh8a1 c.94.1.1 (A:1-210) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieragtdgqdqteardqlvarvqgvvfgq
Sequence, based on observed residues (ATOM records): (download)
>d1nh8a1 c.94.1.1 (A:1-210) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
lieraeardqlvarvqgvvfgq
SCOPe Domain Coordinates for d1nh8a1:
Click to download the PDB-style file with coordinates for d1nh8a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nh8a1:
- d1nh8a1 first appeared in SCOP 1.63
- d1nh8a1 appears in SCOPe 2.07
View in 3D
