SCOPe 2.01: Domain d1ngwb2: 1ngw B:115-216

Lineage for d1ngwb2 (1ngw B:115-216)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

Domain d1ngwb2: 1ngw B:115-216 [80491]
Other proteins in same PDB: d1ngwa1, d1ngwa2, d1ngwb1, d1ngwh1, d1ngwl1, d1ngwl2
part of metal chelatase catalytic Fab 7G12; chimeric affinity matured antibody
complexed with mmp

Details for d1ngwb2

PDB Entry: 1ngw (more details), 2.6 Å

PDB Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin

PDB Compounds: (B:) Mature Metal Chelatase Catalytic Antibody, Heavy chain

SCOPe Domain Sequences for d1ngwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngwb2 b.1.1.2 (B:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkivpks

SCOPe Domain Coordinates for d1ngwb2:

Click to download the PDB-style file with coordinates for d1ngwb2.
(The format of our PDB-style files is described here.)

Timeline for d1ngwb2: