Lineage for d1ng9a4 (1ng9 A:1-116)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031824Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1031855Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 1031856Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 1031857Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 1031858Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1031870Domain d1ng9a4: 1ng9 A:1-116 [80483]
    Other proteins in same PDB: d1ng9a1, d1ng9a2, d1ng9a3, d1ng9b1, d1ng9b2, d1ng9b3
    complexed with adp, mg; mutant

Details for d1ng9a4

PDB Entry: 1ng9 (more details), 2.6 Å

PDB Description: e.coli muts r697a: an atpase-asymmetry mutant
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1ng9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng9a4 d.75.2.1 (A:1-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOPe Domain Coordinates for d1ng9a4:

Click to download the PDB-style file with coordinates for d1ng9a4.
(The format of our PDB-style files is described here.)

Timeline for d1ng9a4: