Lineage for d1nfda2 (1nfd A:118-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762507Protein T-cell antigen receptor [49125] (7 species)
  7. 1762598Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 1762613Domain d1nfda2: 1nfd A:118-213 [21550]
    Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
    complexed with nag, ndg

Details for d1nfda2

PDB Entry: 1nfd (more details), 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody
PDB Compounds: (A:) n15 alpha-beta T-cell receptor

SCOPe Domain Sequences for d1nfda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nfda2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOPe Domain Coordinates for d1nfda2:

Click to download the PDB-style file with coordinates for d1nfda2.
(The format of our PDB-style files is described here.)

Timeline for d1nfda2: