Lineage for d1neua_ (1neu A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Myelin membrane adhesion molecule P0 [48728] (1 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [48729] (1 PDB entry) 
Domain d1neua_: 1neu A: [19704]
Details for d1neua_
PDB Entry: 1neu (more details), 1.9 Å
PDB Description: structure of myelin membrane adhesion molecule p0
PDB Compounds: (A:) myelin p0 proteinSCOPe Domain Sequences for d1neua_:
Sequence, based on SEQRES records: (download)
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe
Sequence, based on observed residues (ATOM records): (download)
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe
SCOPe Domain Coordinates for d1neua_:
Click to download the PDB-style file with coordinates for d1neua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1neua_:
- d1neua_ first appeared (with stable ids) in SCOP 1.55, called d1neu__
- d1neua_ appears in SCOPe 2.07
View in 3D