Lineage for d1nd7a_ (1nd7 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437266Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1437267Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1437268Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins)
  6. 1437277Protein WW domain-containing protein 1, WWP1 [103308] (1 species)
  7. 1437278Species Human (Homo sapiens) [TaxId:9606] [103309] (1 PDB entry)
  8. 1437279Domain d1nd7a_: 1nd7 A: [91817]

Details for d1nd7a_

PDB Entry: 1nd7 (more details), 2.1 Å

PDB Description: conformational flexibility underlies ubiquitin ligation mediated by the wwp1 hect domain e3 ligase
PDB Compounds: (A:) WW domain-containing protein 1

SCOPe Domain Sequences for d1nd7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]}
hmgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrge
egldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrf
iamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemy
fsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnev
vplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevr
mrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksye
qlkekllfaieete

SCOPe Domain Coordinates for d1nd7a_:

Click to download the PDB-style file with coordinates for d1nd7a_.
(The format of our PDB-style files is described here.)

Timeline for d1nd7a_: