Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) automatically mapped to Pfam PF00632 |
Family d.148.1.1: Hect, E3 ligase catalytic domain [56205] (3 proteins) |
Protein WW domain-containing protein 1, WWP1 [103308] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [103309] (1 PDB entry) |
Domain d1nd7a_: 1nd7 A: [91817] |
PDB Entry: 1nd7 (more details), 2.1 Å
SCOPe Domain Sequences for d1nd7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nd7a_ d.148.1.1 (A:) WW domain-containing protein 1, WWP1 {Human (Homo sapiens) [TaxId: 9606]} hmgfrwklahfrylcqsnalpshvkinvsrqtlfedsfqqimalkpydlrrrlyvifrge egldygglarewffllshevlnpmyclfeyagknnyclqinpastinpdhlsyfcfigrf iamalfhgkfidtgfslpfykrmlskkltikdlesidtefynsliwirdnnieecglemy fsvdmeilgkvtshdlklggsnilvteenkdeyiglmtewrfsrgvqeqtkafldgfnev vplqwlqyfdekelevmlcgmqevdladwqrntvyrhytrnskqiiwfwqfvketdnevr mrllqfvtgtcrlplggfaelmgsngpqkfciekvgkdtwlprshtcfnrldlppyksye qlkekllfaieete
Timeline for d1nd7a_: