Lineage for d1n83a_ (1n83 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1502431Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1502432Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1502433Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1502811Protein Orphan nuclear receptor ROR-alpha [81914] (1 species)
  7. 1502812Species Human (Homo sapiens) [TaxId:9606] [81915] (2 PDB entries)
  8. 1502813Domain d1n83a_: 1n83 A: [80276]
    protein/DNA complex; complexed with clr

Details for d1n83a_

PDB Entry: 1n83 (more details), 1.63 Å

PDB Description: Crystal Structure of the complex between the Orphan Nuclear Hormone Receptor ROR(alpha)-LBD and Cholesterol
PDB Compounds: (A:) Nuclear receptor ROR-alpha

SCOPe Domain Sequences for d1n83a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]}
hhlevlfqgpaelehlaqniskshletcqylreelqqitwqtflqeeienyqnkqrevmw
qlcaikiteaiqyvvefakridgfmelcqndqivllkagslevvfirmcrafdsqnntvy
fdgkyaspdvfkslgcedfisfvfefgkslcsmhltedeialfsafvlmsadrswlqekv
kieklqqkiqlalqhvlqknhredgiltklickvstlralcgrhteklmafkaiypdivr
lhfpplykelf

SCOPe Domain Coordinates for d1n83a_:

Click to download the PDB-style file with coordinates for d1n83a_.
(The format of our PDB-style files is described here.)

Timeline for d1n83a_: