Lineage for d1n6ua1 (1n6u A:1-109)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families) 
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Interferon-alpha/beta receptor beta chain [89199] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89200] (4 PDB entries) 
Domain d1n6ua1: 1n6u A:1-109 [85363]
Details for d1n6ua1
PDB Entry: 1n6u (more details)
PDB Description: nmr structure of the interferon-binding ectodomain of the human interferon receptor
PDB Compounds: (A:) Interferon-alpha/beta receptor beta chainSCOPe Domain Sequences for d1n6ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n6ua1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sydspdytdesctfkislrnfrsilswelknhsivpthytllytimskpedlkvvkncan
ttrsfcdltdewrstheayvtvlegfsgnttlfscshnfwlaidmsfep
SCOPe Domain Coordinates for d1n6ua1:
Click to download the PDB-style file with coordinates for d1n6ua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n6ua1:
- d1n6ua1 first appeared in SCOP 1.65
- d1n6ua1 appears in SCOPe 2.03
- d1n6ua1 appears in SCOPe 2.05
- d1n6ua1 appears in the current release, SCOPe 2.08
View in 3D
