Lineage for d1n62c2 (1n62 C:1-177)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [56189] (5 PDB entries)
  8. Domain d1n62c2: 1n62 C:1-177 [80095]
    Other proteins in same PDB: d1n62a1, d1n62a2, d1n62b1, d1n62b2, d1n62c1, d1n62d1, d1n62d2, d1n62e1, d1n62e2, d1n62f1
    complexed with cub, fad, fes, mcn, po4

Details for d1n62c2

PDB Entry: 1n62 (more details), 1.09 Å

PDB Description: Crystal Structure of the Mo,Cu-CO Dehydrogenase (CODH), n-butylisocyanide-bound state
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1n62c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n62c2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1n62c2 are not available.

Timeline for d1n62c2:

Domains from same chain:
(mouse over for more information)
d1n62c1
Domains from other chains:
(mouse over for more information)
d1n62a1, d1n62a2, d1n62b1, d1n62b2, d1n62d1, d1n62d2, d1n62e1, d1n62e2, d1n62f1, d1n62f2