Lineage for d1n3oa_ (1n3o A:)
- Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.1: Legume lectins [49900] (5 proteins) 
Protein Legume lectin [49904] (23 species) 
Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (9 PDB entries) 
Domain d1n3oa_: 1n3o A: [79967]
complexed with ca, gyp, mn
Details for d1n3oa_
PDB Entry: 1n3o (more details), 2 Å
PDB Description: pterocarcpus angolensis lectin in complex with alpha-methyl glucose
PDB Compounds: (A:) lectin PALSCOPe Domain Sequences for d1n3oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3oa_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
qdslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a
SCOPe Domain Coordinates for d1n3oa_:
Click to download the PDB-style file with coordinates for d1n3oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1n3oa_:
- d1n3oa_ first appeared in SCOP 1.63
- d1n3oa_ appears in SCOPe 2.01
- d1n3oa_ appears in SCOPe 2.03
- d1n3oa_ appears in the current release, SCOPe 2.08
View in 3D
