Lineage for d1n2fa_ (1n2f A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007847Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 3007875Protein Organic hydroperoxide resistance protein Ohr [82786] (3 species)
  7. 3007879Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [82787] (1 PDB entry)
  8. 3007880Domain d1n2fa_: 1n2f A: [79853]
    complexed with dtt

Details for d1n2fa_

PDB Entry: 1n2f (more details), 2.01 Å

PDB Description: crystal structure of p. aeruginosa ohr
PDB Compounds: (A:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d1n2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2fa_ d.227.1.1 (A:) Organic hydroperoxide resistance protein Ohr {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mqtikalytatatatggrdgravssdgvldvklstpremggqggaatnpeqlfaagysac
figamkfvagqrkqtlpadasitgkvgigqipggfglevelhinlpgmereaaealvaaa
hqvcpysnatrgnidvrlnvsv

SCOPe Domain Coordinates for d1n2fa_:

Click to download the PDB-style file with coordinates for d1n2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1n2fa_: