Lineage for d1n1qa_ (1n1q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1989902Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1989920Species Bacillus brevis, Dps [TaxId:1393] [89026] (1 PDB entry)
  8. 1989921Domain d1n1qa_: 1n1q A: [85260]
    complexed with feo

Details for d1n1qa_

PDB Entry: 1n1q (more details), 2.2 Å

PDB Description: crystal structure of a dps protein from bacillus brevis
PDB Compounds: (A:) DPS Protein

SCOPe Domain Sequences for d1n1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]}
mktsiqqlvavllnrqvanwvvlyvklhnfhwnvngpnfftlhekfeelyteasghidtl
aervlsiggspiatlaasleeasikeatggesaaemvssvvndfvdlvgelkvardvade
addeatadmldaieaglekhvwmleafle

SCOPe Domain Coordinates for d1n1qa_:

Click to download the PDB-style file with coordinates for d1n1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1n1qa_: