Lineage for d1n0ja1 (1n0j A:1-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980109Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1980110Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 1980236Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1980300Species Human (Homo sapiens) [TaxId:9606] [46619] (30 PDB entries)
  8. 1980331Domain d1n0ja1: 1n0j A:1-83 [79740]
    Other proteins in same PDB: d1n0ja2, d1n0jb2
    complexed with mn

Details for d1n0ja1

PDB Entry: 1n0j (more details), 2.2 Å

PDB Description: the structure of human mitochondrial mn3+ superoxide dismutase reveals a novel tetrameric interface of two 4-helix bundles
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1n0ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n0ja1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1n0ja1:

Click to download the PDB-style file with coordinates for d1n0ja1.
(The format of our PDB-style files is described here.)

Timeline for d1n0ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n0ja2