Lineage for d1mzja2 (1mzj A:184-336)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (3 families) 
Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins) 
Protein Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway [82561] (1 species) Species Streptomyces sp. r1128 [TaxId:140437] [82562] (1 PDB entry) 
Domain d1mzja2: 1mzj A:184-336 [79701]
complexed with ace, coa
Details for d1mzja2
PDB Entry: 1mzj (more details), 2.1 Å
PDB Description: Crystal Structure of the Priming beta-Ketosynthase from the R1128 Polyketide Biosynthetic Pathway
PDB Compounds: (A:) Beta-ketoacylsynthase IIISCOPe Domain Sequences for d1mzja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]}
gpvvrgidgtglgslhmssswdqyvedpsvgrpalvmdgkrvfrwavadvvpaarealev
agltvgdlvafvphqanlriidvlvdrlgvpehvvvsrdaedtgntssasvalaldrlvr
sgavpgggpalmigfgaglsyagqalllpdpps
SCOPe Domain Coordinates for d1mzja2:
Click to download the PDB-style file with coordinates for d1mzja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mzja2:
- d1mzja2 first appeared in SCOP 1.63
- d1mzja2 appears in SCOPe 2.04
- d1mzja2 appears in SCOPe 2.06
- d1mzja2 appears in the current release, SCOPe 2.08
View in 3D
