Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.42: FUR-like [101027] (1 protein) contains extra N-terminal helix and an alpha+beta dimerisation subdomain |
Protein Ferric uptake regulation protein, FUR [101028] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [101029] (1 PDB entry) |
Domain d1mzba_: 1mzb A: [91497] complexed with zn |
PDB Entry: 1mzb (more details), 1.8 Å
SCOPe Domain Sequences for d1mzba_:
Sequence, based on SEQRES records: (download)
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} mvenselrkaglkvtlprvkilqmldsaeqrhmsaedvykalmeagedvglatvyrvltq feaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrergfe lvdhnlvlyvrkkk
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} mvenselrkaglkvtlprvkilqmldsaqrhmsaedvykalmeagedvglatvyrvltqf eaaglvvrhnfdgghavfeladsghhdhmvcvdtgeviefmdaeiekrqkeivrergfel vdhnlvlyvrkkk
Timeline for d1mzba_: